PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009774713.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 644aa    MW: 73408 Da    PI: 6.2715
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009774713.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS360.23e-1102666392374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     + lL++cA+a+ss d++ a++lL r+++++s++gd ++Rla+y+++AL+arl+++++  y  +++s+ s    ++ l+a+k+f  ++P+  +s++
  XP_009774713.1 266 RGLLTQCAQAMSSYDTRTANELLMRIRQHSSSHGDGTERLAHYLANALEARLSSTGTASYTVFASSRIS---AAHILKAYKAFITACPFKLMSNI 357
                     679***************************************************888888888777777...999******************** PP

            GRAS  97 taNqaIleavege..ervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      aN+ I + + g   +++HiiDf+i +G+QWp+L+q+L+  R+++p +lRiTgv+ p++g   +e++e tg+rL+k++++++vpfefn+ +ak++
  XP_009774713.1 358 FANKYIKKLITGGapRTIHIIDFGILYGFQWPCLIQSLSaLRRGEPIKLRITGVELPQPGfrPAERVEDTGRRLKKYCDRFHVPFEFNA-IAKKW 451
                     **********998899**********************967778888************9*****************************.7**** PP

            GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                     e+++leeL+++++E+l+Vn+ ++l +++de+v  +s+rd vL+l+++++P+++++   +  +n++ Fl+rf eal ++s+lfd++ea++pre+e+
  XP_009774713.1 452 ESITLEELAIDRDEVLVVNSLYRLGNIPDETVVPTSPRDVVLDLIRRIRPDMFIHGVVNGTYNTPFFLTRFREALFHFSTLFDMFEATMPREDED 546
                     *********************************************************************************************** PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     r+  E+e+++r+++nv+aceg+er+er et+++W+ r  +aGFk++pl++++++ ++  +r+ + + ++v+e+s+++++gWk+r ++++S+W+
  XP_009774713.1 547 RKLFEEEVFARDAMNVIACEGTERVERPETYKQWQLRCARAGFKQLPLDQEIVNFVSNKVRREYHKDFSVDEDSQWMLQGWKGRVVYALSCWK 639
                     ***************************************************************9888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.242239619IPR005202Transcription factor GRAS
PfamPF035141.0E-107266639IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MEAIFQEQLF PGADAFIFRH PSSILVDPRE DHVVQNGTIV NRHSFEDYSH VHSNVSDPIV  60
RDGDSSPKEE GEGEGDHSDA MYKYISQMLM EEEDLEYKPC MFHDCMALQA AEKYFSDVLH  120
GSDNITNSPQ FSAIIPQDKV SSSCPDFSNT SSDSIESLQW DLNFESPVSV KSLSGSLLTS  180
FRSPSGLREK KNHHRQDDDQ QRSNKQLATF AADESEPLEM YDNVLLLCPN NPCVLPNEVK  240
KPIKVGRPRS GGKKHSSSKK EIVDLRGLLT QCAQAMSSYD TRTANELLMR IRQHSSSHGD  300
GTERLAHYLA NALEARLSST GTASYTVFAS SRISAAHILK AYKAFITACP FKLMSNIFAN  360
KYIKKLITGG APRTIHIIDF GILYGFQWPC LIQSLSALRR GEPIKLRITG VELPQPGFRP  420
AERVEDTGRR LKKYCDRFHV PFEFNAIAKK WESITLEELA IDRDEVLVVN SLYRLGNIPD  480
ETVVPTSPRD VVLDLIRRIR PDMFIHGVVN GTYNTPFFLT RFREALFHFS TLFDMFEATM  540
PREDEDRKLF EEEVFARDAM NVIACEGTER VERPETYKQW QLRCARAGFK QLPLDQEIVN  600
FVSNKVRREY HKDFSVDEDS QWMLQGWKGR VVYALSCWKP AEQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-412696398375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4499400.0DQ449940.1 Nicotiana tabacum GRAS1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774713.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_016446065.10.0PREDICTED: scarecrow-like protein 14
SwissprotP0C8831e-176SCL33_ARATH; Scarecrow-like protein 33
TrEMBLQ1PCS00.0Q1PCS0_TOBAC; GRAS1
STRINGSolyc01g100200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59450.11e-171GRAS family protein